Carbonic Anhydrase I (CA1) (NM_001738) Human Mass Spec Standard

CAT#: PH306616

CA1 MS Standard C13 and N15-labeled recombinant protein (NP_001729)

Product Images

Coomassie blue staining of purified CA1 protein (Cat# TP306616). The protein was produced from HEK293T cells transfected with CA1 cDNA clone (Cat# RC206616) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206616
• Predicted MW: 28.9 kDa
• Protein Sequence:
  Sequence Link

  >RC206616 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVN
  FEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKAD
  GLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTW
  IICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001729
• RefSeq Size: 1319
• RefSeq ORF: 783
• Synonyms: CA-I; CAB; Car1; HEL-S-11
• Locus ID: 759
• UniProt ID: P00915, V9HWE3
• Cytogenetics: 8q21.2
• Summary: 'Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. This CA1 gene is closely linked to the CA2 and CA3 genes on chromosome 8. It encodes a cytosolic protein that is found at the highest level in erythrocytes. Allelic variants of this gene have been described in some populations. Alternative splicing and the use of alternative promoters results in multiple transcript variants. [provided by RefSeq, Nov 2016]'
• Protein Families: Druggable Genome
• Protein Pathways: Nitrogen metabolism