Carbonic Anhydrase I (CA1) (NM_001738) Human Recombinant Protein
CAT#: TP306616
Recombinant protein of human carbonic anhydrase I (CA1), transcript variant 2
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206616 protein sequence
Red=Cloning site Green=Tags(s) MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVN FEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKAD GLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTW IICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 28.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001729 |
Locus ID | 759 |
UniProt ID | P00915, V9HWE3 |
Cytogenetics | 8q21.2 |
Refseq Size | 1319 |
Refseq ORF | 783 |
Synonyms | CA-I; CAB; Car1; HEL-S-11 |
Summary | Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. This CA1 gene is closely linked to the CA2 and CA3 genes on chromosome 8. It encodes a cytosolic protein that is found at the highest level in erythrocytes. Allelic variants of this gene have been described in some populations. Alternative splicing and the use of alternative promoters results in multiple transcript variants. [provided by RefSeq, Nov 2016] |
Protein Families | Druggable Genome |
Protein Pathways | Nitrogen metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400658 | CA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426993 | CA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426994 | CA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426995 | CA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC431814 | CA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400658 | Transient overexpression lysate of carbonic anhydrase I (CA1), transcript variant 2 |
USD 396.00 |
|
LY426993 | Transient overexpression lysate of carbonic anhydrase I (CA1), transcript variant 1 |
USD 396.00 |
|
LY426994 | Transient overexpression lysate of carbonic anhydrase I (CA1), transcript variant 3 |
USD 396.00 |
|
LY426995 | Transient overexpression lysate of carbonic anhydrase I (CA1), transcript variant 4 |
USD 396.00 |
|
LY431814 | Transient overexpression lysate of carbonic anhydrase I (CA1), transcript variant 5 |
USD 396.00 |
|
PH306616 | CA1 MS Standard C13 and N15-labeled recombinant protein (NP_001729) |
USD 2,055.00 |
|
TP720088 | Recombinant protein of human carbonic anhydrase I (CA1), transcript variant 1 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review