MPPED2 (NM_001584) Human Mass Spec Standard

CAT#: PH306617

MPPED2 MS Standard C13 and N15-labeled recombinant protein (NP_001575)

Product Images

Coomassie blue staining of purified MPPED2 protein (Cat# TP306617). The protein was produced from HEK293T cells transfected with MPPED2 cDNA clone (Cat# RC206617) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206617
• Predicted MW: 33.4 kDa
• Protein Sequence:
  Sequence Link

  >RC206617 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRT
  DGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPS
  VSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDIL
  MTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPT
  NPPIIFDLPNPQGS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001575
• RefSeq Size: 2404
• RefSeq ORF: 882
• Synonyms: 239FB; C11orf8
• Locus ID: 744
• UniProt ID: Q15777
• Cytogenetics: 11p14.1
• Summary: 'This gene likely encodes a metallophosphoesterase. The encoded protein may play a role a brain development. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2009]'