MPPED2 (NM_001584) Human Recombinant Protein

CAT#: TP306617

Recombinant protein of human metallophosphoesterase domain containing 2 (MPPED2), transcript variant 1

Product Images

Coomassie blue staining of purified MPPED2 protein (Cat# TP306617). The protein was produced from HEK293T cells transfected with MPPED2 cDNA clone (Cat# RC206617) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206617 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRT
  DGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPS
  VSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDIL
  MTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPT
  NPPIIFDLPNPQGS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 33.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001575
• Locus ID: 744
• UniProt ID: Q15777
• Cytogenetics: 11p14.1
• Refseq Size: 2404
• Refseq ORF: 882
• Synonyms: 239FB; C11orf8
• Summary: This gene likely encodes a metallophosphoesterase. The encoded protein may play a role a brain development. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2009]