Interleukin 34 (IL34) (NM_152456) Human Mass Spec Standard

CAT#: PH306629

IL34 MS Standard C13 and N15-labeled recombinant protein (NP_689669)

Product Images

Coomassie blue staining of purified IL34 protein (Cat# TP306629). The protein was produced from HEK293T cells transfected with IL34 cDNA clone (Cat# RC206629) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206629
• Predicted MW: 27.5 kDa
• Protein Sequence:
  Sequence Link

  >RC206629 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPRGFTWLRYLGIFLGVALGNEPLEMWPLTQNEECTVTGFLRDKLQYRSRLQYMKHYFPINYKISVPYEG
  VFRIANVTRLQRAQVSERELRYLWVLVSLSATESVQDVLLEGHPSWKYLQEVQTLLLNVQQGLTDVEVSP
  KVESVLSLLNAPGPNLKLVRPKALLDNCFRVMELLYCSCCKQSSVLNWQDCEVPSPQSCSPEPSLQYAAT
  QLYPPPPWSPSSPPHSTGSVRPVRAQGEGLLP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_689669
• RefSeq Size: 1796
• RefSeq ORF: 726
• Synonyms: C16orf77; IL-34
• Locus ID: 146433
• UniProt ID: Q6ZMJ4, A0A024QZ87
• Cytogenetics: 16q22.1
• Summary: Interleukin-34 is a cytokine that promotes the differentiation and viability of monocytes and macrophages through the colony-stimulating factor-1 receptor (CSF1R; MIM 164770) (Lin et al., 2008 [PubMed 18467591]). [supplied by OMIM, May 2008]