Interleukin 34 (IL34) (NM_152456) Human Recombinant Protein

CAT#: TP306629

Recombinant protein of human interleukin 34 (IL34)

Product Images

Coomassie blue staining of purified IL34 protein (Cat# TP306629). The protein was produced from HEK293T cells transfected with IL34 cDNA clone (Cat# RC206629) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206629 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPRGFTWLRYLGIFLGVALGNEPLEMWPLTQNEECTVTGFLRDKLQYRSRLQYMKHYFPINYKISVPYEG
  VFRIANVTRLQRAQVSERELRYLWVLVSLSATESVQDVLLEGHPSWKYLQEVQTLLLNVQQGLTDVEVSP
  KVESVLSLLNAPGPNLKLVRPKALLDNCFRVMELLYCSCCKQSSVLNWQDCEVPSPQSCSPEPSLQYAAT
  QLYPPPPWSPSSPPHSTGSVRPVRAQGEGLLP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 27.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_689669
• Locus ID: 146433
• UniProt ID: Q6ZMJ4, A0A024QZ87
• Cytogenetics: 16q22.1
• Refseq Size: 1796
• Refseq ORF: 726
• Synonyms: C16orf77; IL-34
• Summary: Interleukin-34 is a cytokine that promotes the differentiation and viability of monocytes and macrophages through the colony-stimulating factor-1 receptor (CSF1R; MIM 164770) (Lin et al., 2008 [PubMed 18467591]).[supplied by OMIM, May 2008]