FAM76A (NM_152660) Human Mass Spec Standard
CAT#: PH306630
FAM76A MS Standard C13 and N15-labeled recombinant protein (NP_689873)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206630 |
Predicted MW | 35 kDa |
Protein Sequence |
>RC206630 protein sequence
Red=Cloning site Green=Tags(s) MAALYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQESKTNTICKKCAQNVQLYGTPKP CQYCNIIAAFIGNKCQRCTNSEKKYGPPYSCEQCKQQCAFDRKDDRKKVDGKLLCWLCTLSYKRVLQKTK EQRKHLSSSSRAGHQEKEQYSRLSGGGHYNSQKTLSTSSIQNEIPKKKSKFESITTNGDSFSPDLALDSP GTDHFVIIAQLKEEVATLKKMLHQKDQMILEKEKKITELKADFQYQESQMRAKMNQMEKTHKEVTEQLQA KNRELLKQAAALSKSKKSEKSGAITSP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_689873 |
RefSeq Size | 3360 |
RefSeq ORF | 921 |
Synonyms | RP3-426I6.1 |
Locus ID | 199870 |
UniProt ID | Q8TAV0 |
Cytogenetics | 1p35.3 |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407384 | FAM76A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428401 | FAM76A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428402 | FAM76A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428403 | FAM76A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY407384 | Transient overexpression lysate of family with sequence similarity 76, member A (FAM76A), transcript variant 3 |
USD 396.00 |
|
LY428401 | Transient overexpression lysate of family with sequence similarity 76, member A (FAM76A), transcript variant 1 |
USD 396.00 |
|
LY428402 | Transient overexpression lysate of family with sequence similarity 76, member A (FAM76A), transcript variant 2 |
USD 396.00 |
|
LY428403 | Transient overexpression lysate of family with sequence similarity 76, member A (FAM76A), transcript variant 4 |
USD 396.00 |
|
PH326773 | FAM76A MS Standard C13 and N15-labeled recombinant protein (NP_001137386) |
USD 2,055.00 |
|
TP306630 | Recombinant protein of human family with sequence similarity 76, member A (FAM76A), transcript variant 3 |
USD 823.00 |
|
TP326773 | Purified recombinant protein of Homo sapiens family with sequence similarity 76, member A (FAM76A), transcript variant 4 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review