FAM76A (NM_152660) Human Recombinant Protein
CAT#: TP306630
Recombinant protein of human family with sequence similarity 76, member A (FAM76A), transcript variant 3
View other "FAM76A" proteins (11)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206630 protein sequence
Red=Cloning site Green=Tags(s) MAALYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQESKTNTICKKCAQNVQLYGTPKP CQYCNIIAAFIGNKCQRCTNSEKKYGPPYSCEQCKQQCAFDRKDDRKKVDGKLLCWLCTLSYKRVLQKTK EQRKHLSSSSRAGHQEKEQYSRLSGGGHYNSQKTLSTSSIQNEIPKKKSKFESITTNGDSFSPDLALDSP GTDHFVIIAQLKEEVATLKKMLHQKDQMILEKEKKITELKADFQYQESQMRAKMNQMEKTHKEVTEQLQA KNRELLKQAAALSKSKKSEKSGAITSP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_689873 |
Locus ID | 199870 |
UniProt ID | Q8TAV0 |
Cytogenetics | 1p35.3 |
Refseq Size | 3360 |
Refseq ORF | 921 |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407384 | FAM76A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428401 | FAM76A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428402 | FAM76A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428403 | FAM76A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY407384 | Transient overexpression lysate of family with sequence similarity 76, member A (FAM76A), transcript variant 3 |
USD 396.00 |
|
LY428401 | Transient overexpression lysate of family with sequence similarity 76, member A (FAM76A), transcript variant 1 |
USD 396.00 |
|
LY428402 | Transient overexpression lysate of family with sequence similarity 76, member A (FAM76A), transcript variant 2 |
USD 396.00 |
|
LY428403 | Transient overexpression lysate of family with sequence similarity 76, member A (FAM76A), transcript variant 4 |
USD 396.00 |
|
PH306630 | FAM76A MS Standard C13 and N15-labeled recombinant protein (NP_689873) |
USD 2,055.00 |
|
PH326773 | FAM76A MS Standard C13 and N15-labeled recombinant protein (NP_001137386) |
USD 2,055.00 |
|
TP326773 | Purified recombinant protein of Homo sapiens family with sequence similarity 76, member A (FAM76A), transcript variant 4 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review