Germany
Japan
United Kingdom
China
FAM76A (NM_001143914) Human Mass Spec Standard
CAT#: PH326773
FAM76A MS Standard C13 and N15-labeled recombinant protein (NP_001137386)
Product Images
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC226773 |
| Predicted MW | 31.7 kDa |
| Protein Sequence |
>RC226773 representing NM_001143914
Red=Cloning site Green=Tags(s) MAALYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQESKTNTICKKCAQNVQLYGTPKP CQYCNIIAAFIGNKCQRCTNSEKKYGPPYSCEQCKQQCAFDRKDDRKKVDGKLLCWLCTLSYKRVLQKTK EQRKHLSSSSRAGHQEKEQYSRLSGGGHYNSFSPDLALDSPGTDHFVIIAQLKEEVATLKKMLHQKDQMI LEKEKKITELKADFQYQESQMRAKMNQMEKTHKEVTEQLQAKNRELLKQAAALSKSKKSEKSGAITSP myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_001137386 |
| RefSeq ORF | 834 |
| Synonyms | RP3-426I6.1 |
| Locus ID | 199870 |
| UniProt ID | Q8TAV0 |
| Cytogenetics | 1p35.3 |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407384 | FAM76A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC428401 | FAM76A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC428402 | FAM76A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC428403 | FAM76A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY407384 | Transient overexpression lysate of family with sequence similarity 76, member A (FAM76A), transcript variant 3 |
USD 396.00 |
|
| LY428401 | Transient overexpression lysate of family with sequence similarity 76, member A (FAM76A), transcript variant 1 |
USD 396.00 |
|
| LY428402 | Transient overexpression lysate of family with sequence similarity 76, member A (FAM76A), transcript variant 2 |
USD 396.00 |
|
| LY428403 | Transient overexpression lysate of family with sequence similarity 76, member A (FAM76A), transcript variant 4 |
USD 396.00 |
|
| PH306630 | FAM76A MS Standard C13 and N15-labeled recombinant protein (NP_689873) |
USD 2,055.00 |
|
| TP306630 | Recombinant protein of human family with sequence similarity 76, member A (FAM76A), transcript variant 3 |
USD 823.00 |
|
| TP326773 | Purified recombinant protein of Homo sapiens family with sequence similarity 76, member A (FAM76A), transcript variant 4 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review