IZUMO1 (NM_182575) Human Mass Spec Standard

CAT#: PH306671

IZUMO1 MS Standard C13 and N15-labeled recombinant protein (NP_872381)

Product Images

Coomassie blue staining of purified IZUMO1 protein (Cat# TP306671). The protein was produced from HEK293T cells transfected with IZUMO1 cDNA clone (Cat# RC206671) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206671
• Predicted MW: 39 kDa
• Protein Sequence:
  Sequence Link

  >RC206671 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGPHFTLLCAALAGCLLPAEGCVICDPSVVLALKSLEKDYLPGHLDAKHHKAMMERVENAVKDFQELSLN
  EDAYMGVVDEATLQKGSWSLLKDLKRITDSDVKGDLFVKELFWMLHLQKETFATYVARFQKEAYCPNKCG
  VMLQTLIWCKNCKKEVHACRKSYDCGERNVEVPQMEDMILDCELNWHQASEGLTDYSFYRVWGNNTETLV
  SKGKEATLTKPMVGPEDAGSYRCELGSVNSSPATIINFHVTVLPKMIKEEKPSPNIVTPGEATTESSISL
  QPLQPEKMLASRLLGLLICGSLALITGLTFAIFRRRKVIDFIKSSLFGLGSGVAEQTQVPKEKATDSRQQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_872381
• RefSeq Size: 1621
• RefSeq ORF: 1050
• Synonyms: IZUMO; OBF
• Locus ID: 284359
• UniProt ID: Q8IYV9
• Cytogenetics: 19q13.33
• Summary: The sperm-specific protein Izumo, named for a Japanese shrine dedicated to marriage, is essential for sperm-egg plasma membrane binding and fusion (Inoue et al., 2005 [PubMed 15759005]). [supplied by OMIM, Mar 2008]
• Protein Families: Transmembrane