RDHE2 (SDR16C5) (NM_138969) Human Mass Spec Standard

CAT#: PH306759

SDR16C5 MS Standard C13 and N15-labeled recombinant protein (NP_620419)

Product Images

Coomassie blue staining of purified SDR16C5 protein (Cat# TP306759). The protein was produced from HEK293T cells transfected with SDR16C5 cDNA clone (Cat# RC206759) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206759
• Predicted MW: 34.1 kDa
• Protein Sequence:
  Sequence Link

  >RC206759 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSFNLQSSKKLFIFLGKSLFSLLEAMIFALLPKPRKNVAGEIVLITGAGSGLGRLLALQFARLGSVLVLW
  DINKEGNEETCKMAREAGATRVHAYTCDCSQKEGVYRVADQVKKEVGDVSILINNAGIVTGKKFLDCPDE
  LMEKSFDVNFKAHLWTYKAFLPAMIANDHGHLVCISSSAGLSGVNGLADYCASKFAAFGFAESVFVETFV
  QKQKGIKTTIVCPFFIKTGMFEGCTTGCPSLLPILEPKYAVEKIVEAILQEKMYLYMPKLLYFMMFLKSF
  LPLKTGLLIADYLGILHAMDGFVDQKKKL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_620419
• RefSeq Size: 3039
• RefSeq ORF: 927
• Synonyms: EPHD-2; RDH#2; RDH-E2; RDHE2; retSDR2
• Locus ID: 195814
• UniProt ID: Q8N3Y7, B3KT84
• Cytogenetics: 8q12.1
• Summary: This gene encodes a member of the short-chain alcohol dehydrogenase/reductase superfamily of proteins and is involved in the oxidation of retinol to retinaldehyde. The encoded protein is associated with the endoplasmic reticulum and is predicted to contain three transmembrane helices, suggesting that it is an integral membrane protein. It recognizes all-trans-retinol and all-trans-retinaldehyde as substrates and exhibits a strong preference for NAD(+)/NADH as cofactors. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]
• Protein Families: Druggable Genome