MRFAP1 (NM_033296) Human Mass Spec Standard

CAT#: PH306815

MRFAP1 MS Standard C13 and N15-labeled recombinant protein (NP_150638)

Product Images

Coomassie blue staining of purified MRFAP1 protein (Cat# TP306815). The protein was produced from HEK293T cells transfected with MRFAP1 cDNA clone (Cat# RC206815) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206815
• Predicted MW: 14.6 kDa
• Protein Sequence:
  Sequence Link

  >RC206815 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRPLDIVELAEPEEVEVLEPEEDFEQFLLPVINEMREDIASLTREHGRAYLRNRSKLWEMDNMLIQIKTQ
  VEASEESALNHLQNPGDAAEGRAAKRCEKAEEKAKEIAKMAEMLVELVRRIEKSESS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_150638
• RefSeq Size: 2184
• RefSeq ORF: 381
• Synonyms: PAM14; PGR1
• Locus ID: 93621
• UniProt ID: Q9Y605, B3KQA0
• Cytogenetics: 4p16.1
• Summary: This gene encodes an intracellular protein that interacts with members of the MORF4/MRG (mortality factor on chromosome 4/MORF4 related gene) family and the tumor suppressor Rb (retinoblastoma protein.) The protein may play a role in senescence, cell growth and immortalization. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2013]