Ornithine Decarboxylase (ODC1) (NM_002539) Human Mass Spec Standard

CAT#: PH306858

ODC1 MS Standard C13 and N15-labeled recombinant protein (NP_002530)

Product Images

Coomassie blue staining of purified ODC1 protein (Cat# TP306858). The protein was produced from HEK293T cells transfected with ODC1 cDNA clone (Cat# RC206858) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206858
• Predicted MW: 51.1 kDa
• Protein Sequence:
  Sequence Link

  >RC206858 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKC
  NDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELM
  KVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLRTSRLLLERAKELNIDVVGVSFHVGSGCTDPETFVQ
  AISDARCVFDMGAEVGFSMYLLDIGGGFPGSEDVKLKFEEITGVINPALDKYFPSDSGVRIIAEPGRYYV
  ASAFTLAVNIIAKKIVLKEQTGSDDEDESSEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKY
  YSSSIWGPTCDGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPAWQLMQQF
  QNPDFPPEVEEQDASTLPVSCAWESGMKRHRAACASASINV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002530
• RefSeq Size: 2307
• RefSeq ORF: 1383
• Synonyms: ODC
• Locus ID: 4953
• UniProt ID: P11926
• Cytogenetics: 2p25.1
• Summary: 'This gene encodes the rate-limiting enzyme of the polyamine biosynthesis pathway which catalyzes ornithine to putrescine. The activity level for the enzyme varies in response to growth-promoting stimuli and exhibits a high turnover rate in comparison to other mammalian proteins. Originally localized to both chromosomes 2 and 7, the gene encoding this enzyme has been determined to be located on 2p25, with a pseudogene located on 7q31-qter. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Dec 2013]'
• Protein Families: Druggable Genome
• Protein Pathways: Arginine and proline metabolism, Glutathione metabolism, Metabolic pathways