Ornithine Decarboxylase (ODC1) (NM_002539) Human Recombinant Protein
CAT#: TP721016
Purified recombinant protein of Human ornithine decarboxylase 1 (ODC1)
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MASMTGGQQMGRGSMNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLRTSRLLLERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPGS
|
Tag | C-His |
Predicted MW | 53.5 kDa |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Supplied as a 0.2 µM filtered solution of 20mM Tris-HCl,150mM NaCl, pH 8.0 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 3 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002530 |
Locus ID | 4953 |
UniProt ID | P11926 |
Cytogenetics | 2p25.1 |
Refseq Size | 2307 |
Refseq ORF | 1383 |
Synonyms | ODC |
Summary | 'This gene encodes the rate-limiting enzyme of the polyamine biosynthesis pathway which catalyzes ornithine to putrescine. The activity level for the enzyme varies in response to growth-promoting stimuli and exhibits a high turnover rate in comparison to other mammalian proteins. Originally localized to both chromosomes 2 and 7, the gene encoding this enzyme has been determined to be located on 2p25, with a pseudogene located on 7q31-qter. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Dec 2013]' |
Protein Families | Druggable Genome |
Protein Pathways | Arginine and proline metabolism, Glutathione metabolism, Metabolic pathways |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400909 | ODC1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400909 | Transient overexpression lysate of ornithine decarboxylase 1 (ODC1) |
USD 325.00 |
|
PH306858 | ODC1 MS Standard C13 and N15-labeled recombinant protein (NP_002530) |
USD 2,055.00 |
|
TP306858 | Recombinant protein of human ornithine decarboxylase 1 (ODC1) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review