DHRSX (NM_145177) Human Mass Spec Standard

CAT#: PH307107

DHRSX MS Standard C13 and N15-labeled recombinant protein (NP_660160)

Product Images

Coomassie blue staining of purified DHRSX protein (Cat# TP307107). The protein was produced from HEK293T cells transfected with DHRSX cDNA clone (Cat# RC207107) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207107
• Predicted MW: 36.5 kDa
• Protein Sequence:
  Sequence Link

  >RC207107 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSPLSAARAALRVYAVGAAVILAQLLRRCRGGFLEPVFPPRPDRVAIVTGGTDGIGYSTAKHLARLGMHV
  IIAGNNDSKAKQVVSKIKEETLNDKVEFLYCDLASMTSIRQFVQKFKMKKIPLHVLINNAGVMMVPQRKT
  RDGFEEHFGLNYLGHFLLTNLLLDTLKESGSPGHSARVVTVSSATHYVAELNMDDLQSSACYSPHAAYAQ
  SKLALVLFTYHLQRLLAAEGSHVTANVVDPGVVNTDLYKHVFWATRLAKKLLGWLLFKTPDEGAWTSIYA
  AVTPELEGVGGRYLYNEKETKSLHVTYNQKLQQQLWSKSCEMTGVLDVTL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_660160
• RefSeq Size: 2596
• RefSeq ORF: 990
• Synonyms: CXorf11; DHRS5X; DHRS5Y; DHRSXY; DHRSY; SDR7C6; SDR46C1
• Locus ID: 207063
• UniProt ID: Q8N5I4
• Cytogenetics: Xp22.33 and Yp11.2
• Protein Families: Druggable Genome