DHRSX (NM_145177) Human Recombinant Protein

CAT#: TP307107

Recombinant protein of human dehydrogenase/reductase (SDR family) X-linked (DHRSX)

Product Images

Coomassie blue staining of purified DHRSX protein (Cat# TP307107). The protein was produced from HEK293T cells transfected with DHRSX cDNA clone (Cat# RC207107) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207107 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSPLSAARAALRVYAVGAAVILAQLLRRCRGGFLEPVFPPRPDRVAIVTGGTDGIGYSTAKHLARLGMHV
  IIAGNNDSKAKQVVSKIKEETLNDKVEFLYCDLASMTSIRQFVQKFKMKKIPLHVLINNAGVMMVPQRKT
  RDGFEEHFGLNYLGHFLLTNLLLDTLKESGSPGHSARVVTVSSATHYVAELNMDDLQSSACYSPHAAYAQ
  SKLALVLFTYHLQRLLAAEGSHVTANVVDPGVVNTDLYKHVFWATRLAKKLLGWLLFKTPDEGAWTSIYA
  AVTPELEGVGGRYLYNEKETKSLHVTYNQKLQQQLWSKSCEMTGVLDVTL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 36.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_660160
• Locus ID: 207063
• UniProt ID: Q8N5I4
• Cytogenetics: X;Y
• Refseq Size: 2596
• Refseq ORF: 990
• Synonyms: CXorf11; DHRS5X; DHRS5Y; DHRSXY; DHRSY; SDR7C6; SDR46C1
• Summary: Involved in the positive regulation of starvation-induced autophagy (PubMed:25076851).[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome