FHIT (NM_002012) Human Mass Spec Standard
CAT#: PH307120
FHIT MS Standard C13 and N15-labeled recombinant protein (NP_002003)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207120 |
Predicted MW | 16.9 kDa |
Protein Sequence |
>RC207120 protein sequence
Red=Cloning site Green=Tags(s) MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVE KHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAA ALRVYFQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002003 |
RefSeq Size | 1103 |
RefSeq ORF | 441 |
Synonyms | AP3Aase; FRA3B |
Locus ID | 2272 |
UniProt ID | P49789, A0A024R366 |
Cytogenetics | 3p14.2 |
Summary | 'The protein encoded by this gene is a P1-P3-bis(5'-adenosyl) triphosphate hydrolase involved in purine metabolism. This gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts. In fact, aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas. The encoded protein is also a tumor suppressor, as loss of its activity results in replication stress and DNA damage. [provided by RefSeq, Aug 2017]' |
Protein Pathways | Non-small cell lung cancer, Purine metabolism, Small cell lung cancer |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419588 | FHIT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC431768 | FHIT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY419588 | Transient overexpression lysate of fragile histidine triad gene (FHIT), transcript variant 1 |
USD 325.00 |
|
LY431768 | Transient overexpression lysate of fragile histidine triad gene (FHIT), transcript variant 2 |
USD 325.00 |
|
TP307120 | Recombinant protein of human fragile histidine triad gene (FHIT) |
USD 823.00 |
|
TP328740 | Recombinant protein of human fragile histidine triad gene (FHIT), transcript variant 2. |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review