FHIT (NM_002012) Human Mass Spec Standard

CAT#: PH307120

FHIT MS Standard C13 and N15-labeled recombinant protein (NP_002003)

Product Images

Coomassie blue staining of purified FHIT protein (Cat# TP307120). The protein was produced from HEK293T cells transfected with FHIT cDNA clone (Cat# RC207120) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207120
• Predicted MW: 16.9 kDa
• Protein Sequence:
  Sequence Link

  >RC207120 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVE
  KHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAA
  ALRVYFQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002003
• RefSeq Size: 1103
• RefSeq ORF: 441
• Synonyms: AP3Aase; FRA3B
• Locus ID: 2272
• UniProt ID: P49789, A0A024R366
• Cytogenetics: 3p14.2
• Summary: 'The protein encoded by this gene is a P1-P3-bis(5'-adenosyl) triphosphate hydrolase involved in purine metabolism. This gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts. In fact, aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas. The encoded protein is also a tumor suppressor, as loss of its activity results in replication stress and DNA damage. [provided by RefSeq, Aug 2017]'
• Protein Pathways: Non-small cell lung cancer, Purine metabolism, Small cell lung cancer