TSSK2 (NM_053006) Human Mass Spec Standard

CAT#: PH307232

TSSK2 MS Standard C13 and N15-labeled recombinant protein (NP_443732)

Product Images

Coomassie blue staining of purified TSSK2 protein (Cat# TP307232). The protein was produced from HEK293T cells transfected with TSSK2 cDNA clone (Cat# RC207232) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207232
• Predicted MW: 41 kDa
• Protein Sequence:
  Sequence Link

  >RC207232 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDDATVLRKKGYIVGINLGKGSYAKVKSAYSERLKFNVAVKIIDRKKTPTDFVERFLPREMDILATVNHG
  SIIKTYEIFETSDGRIYIIMELGVQGDLLEFIKCQGALHEDVARKMFRQLSSAVKYCHDLDIVHRDLKCE
  NLLLDKDFNIKLSDFGFSKRCLRDSNGRIILSKTFCGSAAYAAPEVLQSIPYQPKVYDIWSLGVILYIMV
  CGSMPYDDSDIRKMLRIQKEHRVDFPRSKNLTCECKDLIYRMLQPDVSQRLHIDEILSHSWLQPPKPKAT
  SSASFKREGEGKYRAECKLDTKTDLRPDHRPDHKLGAKTQHRLLVVPENENRMEDRLAETSRAKDHHISG
  AEVGKAST
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_443732
• RefSeq Size: 1832
• RefSeq ORF: 1074
• Synonyms: DGS-G; SPOGA2; STK22B; TSK2
• Locus ID: 23617
• UniProt ID: Q96PF2, A0ZT99
• Cytogenetics: 22q11.21
• Summary: TSSK2 belongs to a family of serine/threonine kinases highly expressed in testis (Hao et al., 2004 [PubMed 15044604]). [supplied by OMIM, Mar 2008]
• Protein Families: Druggable Genome, Protein Kinase