TSSK2 (NM_053006) Human Recombinant Protein

CAT#: TP307232

Recombinant protein of human testis-specific serine kinase 2 (TSSK2)


  View other "TSSK2" proteins (3)

USD 823.00

In Stock*

Size
    • 20 ug

Product Images

Frequently bought together (2)
Rabbit Polyclonal Anti-TSSK2 Antibody
    • 100 ul

USD 375.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00

Other products for "TSSK2"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC207232 protein sequence
Red=Cloning site Green=Tags(s)

MDDATVLRKKGYIVGINLGKGSYAKVKSAYSERLKFNVAVKIIDRKKTPTDFVERFLPREMDILATVNHG
SIIKTYEIFETSDGRIYIIMELGVQGDLLEFIKCQGALHEDVARKMFRQLSSAVKYCHDLDIVHRDLKCE
NLLLDKDFNIKLSDFGFSKRCLRDSNGRIILSKTFCGSAAYAAPEVLQSIPYQPKVYDIWSLGVILYIMV
CGSMPYDDSDIRKMLRIQKEHRVDFPRSKNLTCECKDLIYRMLQPDVSQRLHIDEILSHSWLQPPKPKAT
SSASFKREGEGKYRAECKLDTKTDLRPDHRPDHKLGAKTQHRLLVVPENENRMEDRLAETSRAKDHHISG
AEVGKAST

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 40.8 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Bioactivity TSSK2 activity verified in a biochemical assay: TSSK2 (testis-specific serine kinase 2) (TP307232) activity was measured in a homogeneous time-resolved fluorescent (HTRF®) assay. TSSK2 is a serine/threonine kinase that is highly expressed in testis and may be involved in the late stages of spermatogenesis, during the reconstruction of the cytoplasm. Varying concentrations of TSSK2 were added to a reaction mix containing ATP and a biotinylated kinase substrate and the reaction mixture was incubated to allow the protein to phosphorylate the substrate. HTRF detection reagents were then added, and the time-resolved fluorescent signal was measured on a Flexstation 3 microplate reader. The time resolved fluorescent signal is expressed as “delta R” or “ΔR” and is a ratio calculated from the fluorescent emission intensities of the donor and acceptor fluors.
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_443732
Locus ID 23617
UniProt ID Q96PF2, A0ZT99
Cytogenetics 22q11.21
Refseq Size 1832
Refseq ORF 1074
Synonyms DGS-G; SPOGA2; STK22B; TSK2
Summary TSSK2 belongs to a family of serine/threonine kinases highly expressed in testis (Hao et al., 2004 [PubMed 15044604]).[supplied by OMIM, Mar 2008]
Protein Families Druggable Genome, Protein Kinase

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.