TP53I11 (NM_006034) Human Mass Spec Standard

CAT#: PH307402

TP53I11 MS Standard C13 and N15-labeled recombinant protein (NP_006025)

Product Images

Coomassie blue staining of purified TP53I11 protein (Cat# TP307402). The protein was produced from HEK293T cells transfected with TP53I11 cDNA clone (Cat# RC207402) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207402
• Predicted MW: 21.1 kDa
• Protein Sequence:
  Sequence Link

  >RC207402 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAKQPPPLMKKHSQTDLVSRLKTRKILGVGGEDDDGEVHRSKISQVLGNEIKFTIREPLGLRVWQFVSA
  VLFSGIAIMALAFPDQLYDAVFDGAQVTSKTPIRLYGGALLSISLIMWNALYTAEKVIIRWTLLTEACYF
  GVQFLVVTATLAETGLMSLGILLLLVSRLLFVVISIYYYYQVGRRPKKA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006025
• RefSeq Size: 3518
• RefSeq ORF: 567
• Synonyms: PIG11
• Locus ID: 9537
• UniProt ID: O14683
• Cytogenetics: 11p11.2
• Protein Families: Druggable Genome, Transmembrane