TP53I11 (NM_006034) Human Recombinant Protein
CAT#: TP307402
Recombinant protein of human tumor protein p53 inducible protein 11 (TP53I11)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207402 protein sequence
Red=Cloning site Green=Tags(s) MAAKQPPPLMKKHSQTDLVSRLKTRKILGVGGEDDDGEVHRSKISQVLGNEIKFTIREPLGLRVWQFVSA VLFSGIAIMALAFPDQLYDAVFDGAQVTSKTPIRLYGGALLSISLIMWNALYTAEKVIIRWTLLTEACYF GVQFLVVTATLAETGLMSLGILLLLVSRLLFVVISIYYYYQVGRRPKKA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006025 |
Locus ID | 9537 |
UniProt ID | O14683 |
Cytogenetics | 11p11.2 |
Refseq Size | 3518 |
Refseq ORF | 567 |
Synonyms | PIG11 |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416907 | TP53I11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC421367 | TP53I11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425835 | TP53I11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY416907 | Transient overexpression lysate of tumor protein p53 inducible protein 11 (TP53I11) |
USD 396.00 |
|
LY421367 | Transient overexpression lysate of tumor protein p53 inducible protein 11 (TP53I11) |
USD 396.00 |
|
LY425835 | Transient overexpression lysate of tumor protein p53 inducible protein 11 (TP53I11) |
USD 396.00 |
|
PH307402 | TP53I11 MS Standard C13 and N15-labeled recombinant protein (NP_006025) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review