Peroxiredoxin 2 (PRDX2) (NM_005809) Human Mass Spec Standard
CAT#: PH307413
PRDX2 MS Standard C13 and N15-labeled recombinant protein (NP_005800)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207413 |
Predicted MW | 21.7 kDa |
Protein Sequence |
>RC207413 representing NM_005809
Red=Cloning site Green=Tags(s) MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGC EVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQ ITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_005800 |
RefSeq Size | 1039 |
RefSeq ORF | 594 |
Synonyms | HEL-S-2a; NKEF-B; NKEFB; PRP; PRX2; PRXII; PTX1; TDPX1; TPX1; TSA |
Locus ID | 7001 |
UniProt ID | P32119, V9HW12 |
Cytogenetics | 19p13.13 |
Summary | 'This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein plays an antioxidant protective role in cells, and it may contribute to the antiviral activity of CD8(+) T-cells. The crystal structure of this protein has been resolved to 2.7 angstroms. This protein prevents hemolytic anemia from oxidative stress by stabilizing hemoglobin, thus making this gene a therapeutic target for patients with hemolytic anemia. This protein may have a proliferative effect and play a role in cancer development or progression. Related pseudogenes have been identified on chromosomes 5, 6, 10 and 13. [provided by RefSeq, Mar 2013]' |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405644 | PRDX2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC417052 | PRDX2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC429270 | PRDX2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY405644 | Transient overexpression lysate of peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 3 |
USD 325.00 |
|
LY417052 | Transient overexpression lysate of peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 325.00 |
|
LY429270 | Transient overexpression lysate of peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 325.00 |
|
PH309548 | PRDX2 MS Standard C13 and N15-labeled recombinant protein (NP_859428) |
USD 2,055.00 |
|
TP307413 | Recombinant protein of human peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 823.00 |
|
TP309548 | Recombinant protein of human peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 3 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review