CTRP4 (C1QTNF4) (NM_031909) Human Mass Spec Standard

CAT#: PH307458

C1QTNF4 MS Standard C13 and N15-labeled recombinant protein (NP_114115)

Product Images

Coomassie blue staining of purified C1QTNF4 protein (Cat# TP307458). The protein was produced from HEK293T cells transfected with C1QTNF4 cDNA clone (Cat# RC207458) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207458
• Predicted MW: 35.3 kDa
• Protein Sequence:
  Sequence Link

  >RC207458 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLPLLLGLLGPAACWALGPTPGPGSSELRSAFSAARTTPLEGTSEMAVTFDKVYVNIGGDFDVATGQFRC
  RVPGAYFFSFTAGKAPHKSLSVMLVRNRDEVQALAFDEQRRPGARRAASQSAMLQLDYGDTVWLRLHGAP
  QYALGAPGATFSGYLVYADADADAPARGPPAPPEPRSAFSAARTRSLVGSDAGPGPRHQPLAFDTEFVNI
  GGDFDAAAGVFRCRLPGAYFFSFTLGKLPRKTLSVKLMKNRDEVQAMIYDDGASRRREMQSQSVMLALRR
  GDAVWLLSHDHDGYGAYSNHGKYITFSGFLVYPDLAPAAPPGLGASELL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_114115
• RefSeq Size: 1436
• RefSeq ORF: 987
• Synonyms: CTRP4; ZACRP4
• Locus ID: 114900
• UniProt ID: Q9BXJ3, A0A3B0J0L9
• Cytogenetics: 11p11.2
• Protein Families: Secreted Protein