CTRP4 (C1QTNF4) (NM_031909) Human Recombinant Protein

CAT#: TP307458

Recombinant protein of human C1q and tumor necrosis factor related protein 4 (C1QTNF4)

Product Images

Coomassie blue staining of purified C1QTNF4 protein (Cat# TP307458). The protein was produced from HEK293T cells transfected with C1QTNF4 cDNA clone (Cat# RC207458) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207458 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLPLLLGLLGPAACWALGPTPGPGSSELRSAFSAARTTPLEGTSEMAVTFDKVYVNIGGDFDVATGQFRC
  RVPGAYFFSFTAGKAPHKSLSVMLVRNRDEVQALAFDEQRRPGARRAASQSAMLQLDYGDTVWLRLHGAP
  QYALGAPGATFSGYLVYADADADAPARGPPAPPEPRSAFSAARTRSLVGSDAGPGPRHQPLAFDTEFVNI
  GGDFDAAAGVFRCRLPGAYFFSFTLGKLPRKTLSVKLMKNRDEVQAMIYDDGASRRREMQSQSVMLALRR
  GDAVWLLSHDHDGYGAYSNHGKYITFSGFLVYPDLAPAAPPGLGASELL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 35.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_114115
• Locus ID: 114900
• UniProt ID: Q9BXJ3, A0A3B0J0L9
• Cytogenetics: 11p11.2
• Refseq Size: 1436
• Refseq ORF: 987
• Synonyms: CTRP4; ZACRP4
• Summary: May be involved in the regulation of the inflammatory network. Its role as pro- or anti-inflammatory seems to be context dependent (PubMed:21658842, PubMed:27086950). Seems to have some role in regulating food intake and energy balance when administered in the brain. This effect is sustained over a two-day period, and it is accompanied by decreased expression of orexigenic neuropeptides in the hypothalamus 3 h post-injection (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Families: Secreted Protein