FNDC4 (NM_022823) Human Mass Spec Standard

CAT#: PH307471

FNDC4 MS Standard C13 and N15-labeled recombinant protein (NP_073734)

Product Images

Coomassie blue staining of purified FNDC4 protein (Cat# TP307471). The protein was produced from HEK293T cells transfected with FNDC4 cDNA clone (Cat# RC207471) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207471
• Predicted MW: 25.2 kDa
• Protein Sequence:
  Sequence Link

  >RC207471 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPSGCHSSPPSGLRGDMASLVPLSPYLSPTVLLLVSCDLGFVRADRPPSPVNVTVTHLRANSATVSWDVP
  EGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKG
  SDRLPSNSSSPGDITVEGLDGERPLQTGEVVIIVVVLLMWAAVIGLFCRQYDIIKDNDSNNNPKEKGKGP
  EQSPQGRPVGTRQKKSPSINTIDV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_073734
• RefSeq Size: 1697
• RefSeq ORF: 702
• Synonyms: FRCP1
• Locus ID: 64838
• UniProt ID: Q9H6D8
• Cytogenetics: 2p23.3
• Summary: Acts as an anti-inflammatory factor in the intestine and colon. Binds to and acts on macrophages to downregulate pro-inflammatory gene expression. Affects key macrophage functions, including phagocytosis, by downregulating many key pathways for macrophage activation, partly via by STAT3 activation and signaling. May be required to dampen the immunological response in colitis. [UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane