GOLPH3 (NM_022130) Human Mass Spec Standard

CAT#: PH307477

GOLPH3 MS Standard C13 and N15-labeled recombinant protein (NP_071413)

Product Images

Coomassie blue staining of purified GOLPH3 protein (Cat# TP307477). The protein was produced from HEK293T cells transfected with GOLPH3 cDNA clone (Cat# RC207477) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207477
• Predicted MW: 33.8 kDa
• Protein Sequence:
  Sequence Link

  >RC207477 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDDDKGDSKETRLTLMEEVLLLG
  LKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHV
  KETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIK
  QRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVEC
  LKANTNEVLWAVVAAFTK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_071413
• RefSeq Size: 2676
• RefSeq ORF: 894
• Synonyms: GOPP1; GPP34; MIDAS; Vps74
• Locus ID: 64083
• UniProt ID: Q9H4A6
• Cytogenetics: 5p13.3
• Summary: The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a peripheral membrane protein of the Golgi stack and may have a regulatory role in Golgi trafficking. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of these variants has not been determined. [provided by RefSeq, Jul 2008]