GOLPH3 (NM_022130) Human Recombinant Protein

CAT#: TP307477

Recombinant protein of human golgi phosphoprotein 3 (coat-protein) (GOLPH3)

Product Images

Coomassie blue staining of purified GOLPH3 protein (Cat# TP307477). The protein was produced from HEK293T cells transfected with GOLPH3 cDNA clone (Cat# RC207477) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207477 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDDDKGDSKETRLTLMEEVLLLG
  LKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHV
  KETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIK
  QRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVEC
  LKANTNEVLWAVVAAFTK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 33.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_071413
• Locus ID: 64083
• UniProt ID: Q9H4A6
• Cytogenetics: 5p13.3
• Refseq Size: 2676
• Refseq ORF: 894
• Synonyms: GOPP1; GPP34; MIDAS; Vps74
• Summary: The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a peripheral membrane protein of the Golgi stack and may have a regulatory role in Golgi trafficking. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of these variants has not been determined. [provided by RefSeq, Jul 2008]