C20orf77 (RPRD1B) (NM_021215) Human Mass Spec Standard

CAT#: PH307481

RPRD1B MS Standard C13 and N15-labeled recombinant protein (NP_067038)

Product Images

Coomassie blue staining of purified RPRD1B protein (Cat# TP307481). The protein was produced from HEK293T cells transfected with RPRD1B cDNA clone (Cat# RC207481) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207481
• Predicted MW: 36.9 kDa
• Protein Sequence:
  Sequence Link

  >RC207481 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSFSESALEKKLSELSNSQHSVQTLSLWLIHHRKHAGPIVSVWHRELRKAKSNRKLTFLYLANDVIQNS
  KRKGPEFTREFESVLVDAFSHVAREADEGCKKPLERLLNIWQERSVYGGEFIQQLKLSMEDSKSPPPKAT
  EEKKSLKRTFQQIQEEEDDDYPGSYSPQDPSAGPLLTEELIKALQDLENAASGDATVRQKIASLPQEVQD
  VSLLEKITDKEAAERLSKTVDEACLLLAEYNGRLAAELEDRRQLARMLVEYTQNQKDVLSEKEKKLEEYK
  QKLARVTQVRKELKSHIQSLPDLSLLPNVTGGLAPLPSAGDLFSTD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_067038
• RefSeq Size: 3895
• RefSeq ORF: 978
• Synonyms: C20orf77; CREPT; dJ1057B20.2; K-H; Kub5-Hera; NET60
• Locus ID: 58490
• UniProt ID: Q9NQG5
• Cytogenetics: 20q11.23
• Summary: Interacts with phosphorylated C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit POLR2A, and participates in dephosphorylation of the CTD by RPAP2. Transcriptional regulator which enhances expression of CCND1. Promotes binding of RNA polymerase II to the CCDN1 promoter and to the termination region before the poly-A site but decreases its binding after the poly-A site. Prevents RNA polymerase II from reading through the 3' end termination site and may allow it to be recruited back to the promoter through promotion of the formation of a chromatin loop. Also enhances the transcription of a number of other cell cycle-related genes including CDK2, CDK4, CDK6 and cyclin-E but not CDKN1A, CDKN1B or cyclin-A. Promotes cell proliferation. [UniProtKB/Swiss-Prot Function]