C20orf77 (RPRD1B) (NM_021215) Human Recombinant Protein

CAT#: TP307481

Recombinant protein of human regulation of nuclear pre-mRNA domain containing 1B (RPRD1B)

Product Images

Coomassie blue staining of purified RPRD1B protein (Cat# TP307481). The protein was produced from HEK293T cells transfected with RPRD1B cDNA clone (Cat# RC207481) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207481 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSFSESALEKKLSELSNSQHSVQTLSLWLIHHRKHAGPIVSVWHRELRKAKSNRKLTFLYLANDVIQNS
  KRKGPEFTREFESVLVDAFSHVAREADEGCKKPLERLLNIWQERSVYGGEFIQQLKLSMEDSKSPPPKAT
  EEKKSLKRTFQQIQEEEDDDYPGSYSPQDPSAGPLLTEELIKALQDLENAASGDATVRQKIASLPQEVQD
  VSLLEKITDKEAAERLSKTVDEACLLLAEYNGRLAAELEDRRQLARMLVEYTQNQKDVLSEKEKKLEEYK
  QKLARVTQVRKELKSHIQSLPDLSLLPNVTGGLAPLPSAGDLFSTD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 36.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_067038
• Locus ID: 58490
• UniProt ID: Q9NQG5
• Cytogenetics: 20q11.23
• Refseq Size: 3895
• Refseq ORF: 978
• Synonyms: C20orf77; CREPT; dJ1057B20.2; K-H; Kub5-Hera; NET60
• Summary: Interacts with phosphorylated C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit POLR2A, and participates in dephosphorylation of the CTD by RPAP2. Transcriptional regulator which enhances expression of CCND1. Promotes binding of RNA polymerase II to the CCDN1 promoter and to the termination region before the poly-A site but decreases its binding after the poly-A site. Prevents RNA polymerase II from reading through the 3' end termination site and may allow it to be recruited back to the promoter through promotion of the formation of a chromatin loop. Also enhances the transcription of a number of other cell cycle-related genes including CDK2, CDK4, CDK6 and cyclin-E but not CDKN1A, CDKN1B or cyclin-A. Promotes cell proliferation.[UniProtKB/Swiss-Prot Function]