Neuroglobin (NGB) (NM_021257) Human Mass Spec Standard

CAT#: PH307482

NGB MS Standard C13 and N15-labeled recombinant protein (NP_067080)

Product Images

Coomassie blue staining of purified NGB protein (Cat# TP307482). The protein was produced from HEK293T cells transfected with NGB cDNA clone (Cat# RC207482) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207482
• Predicted MW: 16.9 kDa
• Protein Sequence:
  Sequence Link

  >RC207482 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVML
  VIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAV
  VQAMSRGWDGE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_067080
• RefSeq Size: 1885
• RefSeq ORF: 453
• Locus ID: 58157
• UniProt ID: Q9NPG2, A0M8W9
• Cytogenetics: 14q24.3
• Summary: This gene encodes an oxygen-binding protein that is distantly related to members of the globin gene family. It is highly conserved among other vertebrates. It is expressed in the central and peripheral nervous system where it may be involved in increasing oxygen availability and providing protection under hypoxic/ischemic conditions. [provided by RefSeq, Jul 2008]