Neuroglobin (NGB) (NM_021257) Human Recombinant Protein

CAT#: TP307482

Recombinant protein of human neuroglobin (NGB)

Product Images

Coomassie blue staining of purified NGB protein (Cat# TP307482). The protein was produced from HEK293T cells transfected with NGB cDNA clone (Cat# RC207482) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207482 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVML
  VIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAV
  VQAMSRGWDGE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 16.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_067080
• Locus ID: 58157
• UniProt ID: Q9NPG2, A0M8W9, F6ZE01, A0A1L1SVG2
• Cytogenetics: 14q24.3
• Refseq Size: 1885
• Refseq ORF: 453
• Summary: This gene encodes an oxygen-binding protein that is distantly related to members of the globin gene family. It is highly conserved among other vertebrates. It is expressed in the central and peripheral nervous system where it may be involved in increasing oxygen availability and providing protection under hypoxic/ischemic conditions. [provided by RefSeq, Jul 2008]