TRAPPC1 (NM_021210) Human Mass Spec Standard

CAT#: PH307483

TRAPPC1 MS Standard C13 and N15-labeled recombinant protein (NP_067033)

Product Images

Coomassie blue staining of purified TRAPPC1 protein (Cat# TP307483). The protein was produced from HEK293T cells transfected with TRAPPC1 cDNA clone (Cat# RC207483) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207483
• Predicted MW: 16.8 kDa
• Protein Sequence:
  Sequence Link

  >RC207483 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTVHNLYLFDRNGVCLHYSEWHRKKQAGIPKEEEYKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYK
  LHYYETPTGIKVVMNTDLGVGPIRDVLHHIYSALYVELVVKNPLCPLGQTVQSELFRSRLDSYVRSLPFF
  SARAG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_067033
• RefSeq Size: 837
• RefSeq ORF: 435
• Synonyms: BET5; MUM2
• Locus ID: 58485
• UniProt ID: Q9Y5R8
• Cytogenetics: 17p13.1
• Summary: This gene product plays a role in vesicular transport of proteins to the Golgi apparatus from the endoplasmic reticulum. The encoded protein is a component of the multisubunit transport protein particle (TRAPP) complex. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]