TRAPPC1 (NM_021210) Human Recombinant Protein
CAT#: TP307483
Recombinant protein of human trafficking protein particle complex 1 (TRAPPC1)
View other "TRAPPC1" proteins (5)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207483 protein sequence
Red=Cloning site Green=Tags(s) MTVHNLYLFDRNGVCLHYSEWHRKKQAGIPKEEEYKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYK LHYYETPTGIKVVMNTDLGVGPIRDVLHHIYSALYVELVVKNPLCPLGQTVQSELFRSRLDSYVRSLPFF SARAG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_067033 |
Locus ID | 58485 |
UniProt ID | Q9Y5R8 |
Cytogenetics | 17p13.1 |
Refseq Size | 837 |
Refseq ORF | 435 |
Synonyms | BET5; MUM2 |
Summary | This gene product plays a role in vesicular transport of proteins to the Golgi apparatus from the endoplasmic reticulum. The encoded protein is a component of the multisubunit transport protein particle (TRAPP) complex. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Oct 2009] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412013 | TRAPPC1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC432581 | TRAPPC1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY412013 | Transient overexpression lysate of trafficking protein particle complex 1 (TRAPPC1), transcript variant 1 |
USD 396.00 |
|
LY432581 | Transient overexpression lysate of trafficking protein particle complex 1 (TRAPPC1), transcript variant 2 |
USD 396.00 |
|
PH307483 | TRAPPC1 MS Standard C13 and N15-labeled recombinant protein (NP_067033) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review