MARCH2 (NM_016496) Human Mass Spec Standard

CAT#: PH307517

MARCH2 MS Standard C13 and N15-labeled recombinant protein (NP_057580)

Product Images

Coomassie blue staining of purified MARCH2 protein (Cat# TP307517). The protein was produced from HEK293T cells transfected with MARCH2 cDNA clone (Cat# RC207517) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207517
• Predicted MW: 27 kDa
• Protein Sequence:
  Sequence Link

  >RC207517 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRTLDTPSDGPFCRICHEG
  ANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLCC
  DMVCFLFITPLAAISGWLCLRGAQDHLRLHSQLEAVGLIALTIALFTIYVLWTLVSFRYHCQLYSEWRKT
  NQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057580
• RefSeq Size: 1705
• RefSeq ORF: 738
• Synonyms: HSPC240; MARCH-II; RNF172
• Locus ID: 51257
• UniProt ID: Q9P0N8
• Cytogenetics: 19p13.2
• Summary: MARCH2 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). MARCH enzymes add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their vesicular transport between membrane compartments. MARCH2 reduces surface accumulation of several glycoproteins and appears to regulate early endosome-to-trans-Golgi network (TGN) trafficking (Bartee et al., 2004 [PubMed 14722266]; Nakamura et al., 2005 [PubMed 15689499]). [supplied by OMIM, Mar 2010]
• Protein Families: Druggable Genome, Transmembrane