DHDH (NM_014475) Human Mass Spec Standard
CAT#: PH307537
DHDH MS Standard C13 and N15-labeled recombinant protein (NP_055290)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207537 |
Predicted MW | 36.4 kDa |
Protein Sequence |
>RC207537 protein sequence
Red=Cloning site Green=Tags(s) MALRWGIVSVGLISSDFTAVLQTLPRSEHQVVAVAARDLSRAKEFAQKHDIPKAYGSYEELAKDPSVEVA YIGTQHPQHKAAVMLCLAAGKAVLCEKPTGVNAAEVREMVAEARSRALFLMEAIWTRFFPASEALRSVLA QGTLGDLRVARAEFGKNLIHVPRAVDRAQAGGALLDIGIYCVQFTSMVFGGQKPEKISVVGRRHETGVDD TVTVLLQYPGEVHGSFTCSITVQLSNTASVSGTKGMVQLLNPCWCPTELVVKGEHKEFPLPPVPKDCNFD NGAGMSYEAKHVWECLRKGMKESPVIPLSESELLADILEEVRKAIGVTFPQDKR SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_055290 |
RefSeq Size | 1098 |
RefSeq ORF | 1002 |
Synonyms | 2DD; HUM2DD |
Locus ID | 27294 |
UniProt ID | Q9UQ10 |
Cytogenetics | 19q13.33 |
Summary | This gene encodes an enzyme that belongs to the family of dihydrodiol dehydrogenases, which exist in multiple forms in mammalian tissues and are involved in the metabolism of xenobiotics and sugars. These enzymes catalyze the NADP1-linked oxidation of transdihydrodiols of aromatic hydrocarbons to corresponding catechols. This enzyme is a dimeric dihydrodiol dehydrogenase, and it differs from monomeric dihydrodiol dehydrogenases in its high substrate specificity for trans-dihydrodiols of aromatic hydrocarbons in the oxidative direction. [provided by RefSeq, Jul 2008] |
Protein Pathways | Metabolism of xenobiotics by cytochrome P450 |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415257 | DHDH HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY415257 | Transient overexpression lysate of dihydrodiol dehydrogenase (dimeric) (DHDH) |
USD 396.00 |
|
TP307537 | Recombinant protein of human dihydrodiol dehydrogenase (dimeric) (DHDH) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review