BST2 (NM_004335) Human Mass Spec Standard

CAT#: PH307540

BST2 MS Standard C13 and N15-labeled recombinant protein (NP_004326)

Product Images

Coomassie blue staining of purified BST2 protein (Cat# TP307540). The protein was produced from HEK293T cells transfected with BST2 cDNA clone (Cat# RC207540) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207540
• Predicted MW: 19.8 kDa
• Protein Sequence:
  Sequence Link

  >RC207540 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASTSYDYCRVPMEDGDKRCKLLLGIGILVLLIIVILGVPLIIFTIKANSEACRDGLRAVMECRNVTHLL
  QQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRE
  NQVLSVRIADKKYYPSSQDSSSAAAPQLLIVLLGLSALLQ
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004326
• RefSeq Size: 1048
• RefSeq ORF: 540
• Synonyms: CD317; TETHERIN
• Locus ID: 684
• UniProt ID: Q10589, A0A024R7H5
• Cytogenetics: 19p13.11
• Summary: 'Bone marrow stromal cells are involved in the growth and development of B-cells. The specific function of the protein encoded by the bone marrow stromal cell antigen 2 is undetermined; however, this protein may play a role in pre-B-cell growth and in rheumatoid arthritis. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Transmembrane