BST2 (NM_004335) Human Recombinant Protein

CAT#: TP307540

Recombinant protein of human bone marrow stromal cell antigen 2 (BST2)

Product Images

Coomassie blue staining of purified BST2 protein (Cat# TP307540). The protein was produced from HEK293T cells transfected with BST2 cDNA clone (Cat# RC207540) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >Peptide sequence encoded by RC207540
  Blue=ORF Red=Cloning site Green=Tag(s)
  
  MASTSYDYCRVPMEDGDKRCKLLLGIGILVLLIIVILGVPLIIFTIKANSEACRDGLRAVMECRNVTHL
  LQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLR
  RENQVLSVRIADKKYYPSSQDSSSAAAPQLLIVLLGLSALLQ
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
  
  Recombinant protein using RC207540 also available, TP307540M
• Tag: C-Myc/DDK
• Predicted MW: 19.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004326
• Locus ID: 684
• UniProt ID: Q10589, A0A024R7H5
• Cytogenetics: 19p13.11
• Refseq Size: 1048
• Refseq ORF: 540
• Synonyms: CD317; HM1.24; TETHERIN
• Summary: Bone marrow stromal cells are involved in the growth and development of B-cells. The specific function of the protein encoded by the bone marrow stromal cell antigen 2 is undetermined; however, this protein may play a role in pre-B-cell growth and in rheumatoid arthritis. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Transmembrane