BST2 (NM_004335) Human Recombinant Protein

CAT#: TP307540

Recombinant protein of human bone marrow stromal cell antigen 2 (BST2)


  View other "BST2" proteins (3)

Special Offer: Get a 15% discount on this product. Use code: “NEURO15".

USD 439.00

In Stock*

Size
    • 20 ug

Product Images

Frequently bought together (2)
Rabbit Monoclonal antibody against CD317 / BST2
    • 100 ul

USD 516.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 412.00

Other products for "BST2"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>Peptide sequence encoded by RC207540
Blue=ORF Red=Cloning site Green=Tag(s)

MASTSYDYCRVPMEDGDKRCKLLLGIGILVLLIIVILGVPLIIFTIKANSEACRDGLRAVMECRNVTHL
LQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLR
RENQVLSVRIADKKYYPSSQDSSSAAAPQLLIVLLGLSALLQ

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV

Recombinant protein using RC207540 also available, TP307540M
Tag C-Myc/DDK
Predicted MW 19.6 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_004326
Locus ID 684
UniProt ID Q10589, A0A024R7H5
Cytogenetics 19p13.11
Refseq Size 1048
Refseq ORF 540
Synonyms CD317; HM1.24; TETHERIN
Summary Bone marrow stromal cells are involved in the growth and development of B-cells. The specific function of the protein encoded by the bone marrow stromal cell antigen 2 is undetermined; however, this protein may play a role in pre-B-cell growth and in rheumatoid arthritis. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.