DDAH1 (NM_012137) Human Mass Spec Standard

CAT#: PH307548

DDAH1 MS Standard C13 and N15-labeled recombinant protein (NP_036269)

Product Images

Coomassie blue staining of purified DDAH1 protein (Cat# TP307548). The protein was produced from HEK293T cells transfected with DDAH1 cDNA clone (Cat# RC207548) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207548
• Predicted MW: 31.1 kDa
• Protein Sequence:
  Sequence Link

  >RC207548 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGLGHPAAFGRATHAVVRALPESLGQHALRSAKGEEVDVARAERQHQLYVGVLGSKLGLQVVELPADES
  LPDCVFVEDVAVVCEETALITRPGAPSRRKEVDMMKEALEKLQLNIVEMKDENATLDGGDVLFTGREFFV
  GLSKRTNQRGAEILADTFKDYAVSTVPVADGLHLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYD
  KLTVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLIN
  KKVDS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_036269
• RefSeq Size: 3991
• RefSeq ORF: 855
• Synonyms: DDAH; DDAH-1; DDAHI; HEL-S-16
• Locus ID: 23576
• UniProt ID: O94760, B2R644
• Cytogenetics: 1p22.3
• Summary: This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. [provided by RefSeq, Jul 2008]