DDAH1 (NM_012137) Human Mass Spec Standard
CAT#: PH307548
DDAH1 MS Standard C13 and N15-labeled recombinant protein (NP_036269)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207548 |
Predicted MW | 31.1 kDa |
Protein Sequence |
>RC207548 protein sequence
Red=Cloning site Green=Tags(s) MAGLGHPAAFGRATHAVVRALPESLGQHALRSAKGEEVDVARAERQHQLYVGVLGSKLGLQVVELPADES LPDCVFVEDVAVVCEETALITRPGAPSRRKEVDMMKEALEKLQLNIVEMKDENATLDGGDVLFTGREFFV GLSKRTNQRGAEILADTFKDYAVSTVPVADGLHLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYD KLTVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLIN KKVDS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_036269 |
RefSeq Size | 3991 |
RefSeq ORF | 855 |
Synonyms | DDAH; DDAH-1; DDAHI; HEL-S-16 |
Locus ID | 23576 |
UniProt ID | O94760, B2R644 |
Cytogenetics | 1p22.3 |
Summary | This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402166 | DDAH1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC427443 | DDAH1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY402166 | Transient overexpression lysate of dimethylarginine dimethylaminohydrolase 1 (DDAH1), transcript variant 1 |
USD 325.00 |
|
LY427443 | Transient overexpression lysate of dimethylarginine dimethylaminohydrolase 1 (DDAH1), transcript variant 2 |
USD 325.00 |
|
TP307548 | Recombinant protein of human dimethylarginine dimethylaminohydrolase 1 (DDAH1), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review