DDAH1 (NM_012137) Human Recombinant Protein
CAT#: TP307548
Recombinant protein of human dimethylarginine dimethylaminohydrolase 1 (DDAH1), transcript variant 1
View other "DDAH1" proteins (5)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207548 protein sequence
Red=Cloning site Green=Tags(s) MAGLGHPAAFGRATHAVVRALPESLGQHALRSAKGEEVDVARAERQHQLYVGVLGSKLGLQVVELPADES LPDCVFVEDVAVVCEETALITRPGAPSRRKEVDMMKEALEKLQLNIVEMKDENATLDGGDVLFTGREFFV GLSKRTNQRGAEILADTFKDYAVSTVPVADGLHLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYD KLTVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLIN KKVDS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036269 |
Locus ID | 23576 |
UniProt ID | O94760, B2R644 |
Cytogenetics | 1p22.3 |
Refseq Size | 3991 |
Refseq ORF | 855 |
Synonyms | DDAH; DDAH-1; DDAHI; HEL-S-16 |
Summary | This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402166 | DDAH1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC427443 | DDAH1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402166 | Transient overexpression lysate of dimethylarginine dimethylaminohydrolase 1 (DDAH1), transcript variant 1 |
USD 396.00 |
|
LY427443 | Transient overexpression lysate of dimethylarginine dimethylaminohydrolase 1 (DDAH1), transcript variant 2 |
USD 396.00 |
|
PH307548 | DDAH1 MS Standard C13 and N15-labeled recombinant protein (NP_036269) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review