DDAH1 (NM_012137) Human Recombinant Protein

CAT#: TP307548

Recombinant protein of human dimethylarginine dimethylaminohydrolase 1 (DDAH1), transcript variant 1

Product Images

Coomassie blue staining of purified DDAH1 protein (Cat# TP307548). The protein was produced from HEK293T cells transfected with DDAH1 cDNA clone (Cat# RC207548) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207548 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGLGHPAAFGRATHAVVRALPESLGQHALRSAKGEEVDVARAERQHQLYVGVLGSKLGLQVVELPADES
  LPDCVFVEDVAVVCEETALITRPGAPSRRKEVDMMKEALEKLQLNIVEMKDENATLDGGDVLFTGREFFV
  GLSKRTNQRGAEILADTFKDYAVSTVPVADGLHLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYD
  KLTVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLIN
  KKVDS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 30.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_036269
• Locus ID: 23576
• UniProt ID: O94760, B2R644
• Cytogenetics: 1p22.3
• Refseq Size: 3991
• Refseq ORF: 855
• Synonyms: DDAH; DDAH-1; DDAHI; HEL-S-16
• Summary: This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. [provided by RefSeq, Jul 2008]