FGL2 (NM_006682) Human Mass Spec Standard

CAT#: PH307557

FGL2 MS Standard C13 and N15-labeled recombinant protein (NP_006673)

Product Images

Coomassie blue staining of purified FGL2 protein (Cat# TP307557). The protein was produced from HEK293T cells transfected with FGL2 cDNA clone (Cat# RC207557) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207557
• Predicted MW: 50.2 kDa
• Protein Sequence:
  Sequence Link

  >RC207557 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKLANWYWLSSAVLATYGFLVVANNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPK
  QFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPGEVGDNRVRELESEVNKL
  SSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANLTFVVNSLDGKCSKCPSQEQIQSRPVQHLIY
  KDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRR
  EFWLGNDKIHLLTKSKEMILRIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYN
  HDLKFFTTPDKDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGG
  YKSSFKEAKMMIRPKHFKP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006673
• RefSeq Size: 4268
• RefSeq ORF: 1317
• Synonyms: pT49; T49
• Locus ID: 10875
• UniProt ID: Q14314, A4D1B8
• Cytogenetics: 7q11.23
• Summary: The protein encoded by this gene is a secreted protein that is similar to the beta- and gamma-chains of fibrinogen. The carboxyl-terminus of the encoded protein consists of the fibrinogen-related domains (FRED). The encoded protein forms a tetrameric complex which is stabilized by interchain disulfide bonds. This protein may play a role in physiologic functions at mucosal sites. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Secreted Protein