RNF41 (NM_194358) Human Mass Spec Standard

CAT#: PH307568

RNF41 MS Standard C13 and N15-labeled recombinant protein (NP_919339)

Product Images

Coomassie blue staining of purified RNF41 protein (Cat# TP307568). The protein was produced from HEK293T cells transfected with RNF41 cDNA clone (Cat# RC207568) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207568
• Predicted MW: 35.9 kDa
• Protein Sequence:
  Sequence Link

  >RC207568 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGYDVTRFQGDVDEDLICPICSGVLEEPVQAPHCEHAFCNACITQWFSQQQTCPVDRSVVTVAHLRPVPR
  IMRNMLSKLQIACDNAVFGCSAVVRLDNLMSHLSDCEHNPKRPVTCEQGCGLEMPKDELPNHNCIKHLRS
  VVQQQQTRIAELEKTSAEHKHQLAEQKRDIQLLKAYMRAIRSVNPNLQNLEETIEYNEILEWVNSLQPAR
  VTRWGGMISTPDAVLQAVIKRSLVESGCPASIVNELIENAHERSWPQGLATLETRQMNRRYYENYVAKRI
  PGKQAVVVMACENQHMGDDMVQEPGLVMIFAHGVEEI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_919339
• RefSeq Size: 5420
• RefSeq ORF: 954
• Synonyms: FLRF; NRDP1; SBBI03
• Locus ID: 10193
• UniProt ID: Q9H4P4
• Cytogenetics: 12q13.3
• Summary: This gene encodes an E3 ubiquitin ligase. The encoded protein plays a role in type 1 cytokine receptor signaling by controlling the balance between JAK2-associated cytokine receptor degradation and ectodomain shedding. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2011]
• Protein Pathways: Endocytosis