RNF41 (NM_194358) Human Recombinant Protein

CAT#: TP307568

Recombinant protein of human ring finger protein 41 (RNF41), transcript variant 2

Product Images

Coomassie blue staining of purified RNF41 protein (Cat# TP307568). The protein was produced from HEK293T cells transfected with RNF41 cDNA clone (Cat# RC207568) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207568 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGYDVTRFQGDVDEDLICPICSGVLEEPVQAPHCEHAFCNACITQWFSQQQTCPVDRSVVTVAHLRPVPR
  IMRNMLSKLQIACDNAVFGCSAVVRLDNLMSHLSDCEHNPKRPVTCEQGCGLEMPKDELPNHNCIKHLRS
  VVQQQQTRIAELEKTSAEHKHQLAEQKRDIQLLKAYMRAIRSVNPNLQNLEETIEYNEILEWVNSLQPAR
  VTRWGGMISTPDAVLQAVIKRSLVESGCPASIVNELIENAHERSWPQGLATLETRQMNRRYYENYVAKRI
  PGKQAVVVMACENQHMGDDMVQEPGLVMIFAHGVEEI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 27.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_919339
• Locus ID: 10193
• UniProt ID: Q9H4P4
• Cytogenetics: 12q13.3
• Refseq Size: 5420
• Refseq ORF: 954
• Synonyms: FLRF; NRDP1; SBBI03
• Summary: This gene encodes an E3 ubiquitin ligase. The encoded protein plays a role in type 1 cytokine receptor signaling by controlling the balance between JAK2-associated cytokine receptor degradation and ectodomain shedding. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2011]
• Protein Pathways: Endocytosis