FAM119A (METTL21A) (NM_145280) Human Mass Spec Standard

CAT#: PH307629

FAM119A MS Standard C13 and N15-labeled recombinant protein (NP_660323)

Product Images

Coomassie blue staining of purified METTL21A protein (Cat# TP307629). The protein was produced from HEK293T cells transfected with METTL21A cDNA clone (Cat# RC207629) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207629
• Predicted MW: 24.6 kDa
• Protein Sequence:
  Sequence Link

  >RC207629 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALVPYEETTEFGLQKFHKPLATFSFANHTIQIRQDWRHLGVAAVVWDAAIVLSTYLEMGAVELRGRSAV
  ELGAGTGLVGIVAALLGAHVTITDRKVALEFLKSNVQANLPPHIQTKTVVKELTWGQNLGSFSPGEFDLI
  LGADIIYLEETFTDLLQTLEHLCSNHSVILLACRIRYERDNNFLAMLERQFIVRKVHYDPEKDVHIYEAQ
  KRNQKEDL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_660323
• RefSeq Size: 4748
• RefSeq ORF: 654
• Synonyms: FAM119A; HCA557b; HSPA-KMT
• Locus ID: 151194
• UniProt ID: Q8WXB1
• Cytogenetics: 2q33.3
• Summary: Protein-lysine methyltransferase that selectively trimethylates residues in heat shock protein 70 (HSP70) family members. Contributes to the in vivo trimethylation of Lys residues in HSPA1 and HSPA8. In vitro methylates 'Lys-561' in HSPA1, 'Lys-564' in HSPA2, 'Lys-585' in HSPA5, 'Lys-563' in HSPA6 and 'Lys-561' in HSPA8. [UniProtKB/Swiss-Prot Function]