FAM119A (METTL21A) (NM_145280) Human Recombinant Protein

CAT#: TP307629

Recombinant protein of human family with sequence similarity 119, member A (FAM119A), transcript variant 1

Product Images

Coomassie blue staining of purified METTL21A protein (Cat# TP307629). The protein was produced from HEK293T cells transfected with METTL21A cDNA clone (Cat# RC207629) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207629 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALVPYEETTEFGLQKFHKPLATFSFANHTIQIRQDWRHLGVAAVVWDAAIVLSTYLEMGAVELRGRSAV
  ELGAGTGLVGIVAALLGAHVTITDRKVALEFLKSNVQANLPPHIQTKTVVKELTWGQNLGSFSPGEFDLI
  LGADIIYLEETFTDLLQTLEHLCSNHSVILLACRIRYERDNNFLAMLERQFIVRKVHYDPEKDVHIYEAQ
  KRNQKEDL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 24.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_660323
• Locus ID: 151194
• UniProt ID: Q8WXB1
• Cytogenetics: 2q33.3
• Refseq Size: 4748
• Refseq ORF: 654
• Synonyms: FAM119A; HCA557b; HSPA-KMT
• Summary: Protein-lysine methyltransferase that selectively trimethylates residues in heat shock protein 70 (HSP70) family members. Contributes to the in vivo trimethylation of Lys residues in HSPA1 and HSPA8. In vitro methylates 'Lys-561' in HSPA1, 'Lys-564' in HSPA2, 'Lys-585' in HSPA5, 'Lys-563' in HSPA6 and 'Lys-561' in HSPA8.[UniProtKB/Swiss-Prot Function]