MTMR14 (NM_001077525) Human Mass Spec Standard
CAT#: PH307732
MTMR14 MS Standard C13 and N15-labeled recombinant protein (NP_001070993)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207732 |
Predicted MW | 72.2 kDa |
Protein Sequence |
>RC207732 protein sequence
Red=Cloning site Green=Tags(s) MAGARAAAAAASAGSSASSGNQPPQELGLGELLEEFSRTQYRAKDGSGTGGSKVERIEKRCLELFGRDYC FSVIPNTNGDICGHYPRHIVFLEYESSEKEKDTFESTVQVSKLQDLIHRSKMARCRGRFVCPVILFKGKH ICRSATLAGWGELYGRSGYNYFFSGGADDAWADVEDVTEEDCALRSGDTHLFDKVRGYDIKLLRYLSVKY ICDLMVENKKVKFGMNVTSSEKVDKAQRYADFTLLSIPYPGCEFFKEYKDRDYMAEGLIFNWKQDYVDAP LSIPDFLTHSLNIDWSQYQCWDLVQQTQNYLKLLLSLVNSDDDSGLLVHCISGWDRTPLFISLLRLSLWA DGLIHTSLKPTEILYLTVAYDWFLFGHMLVDRLSKGEEIFFFCFNFLKHITSEEFSALKTQRRKSLPARD GGFTLEDICMLRRKDRGSTTSLGSDFSLVMESSPGATGSFTYEAVELVPAGAPTQAAWRKSHSSSPQSVL WNRPQPSEDRLPSQQGLAEARSSSSSSSNHSDNFFRMGSSPLEVPKPRSVDHPLPGSSLSTDYGSWQMVT GCGSIQERAVLHTDSSLPFSFPDELPNSCLLAALSDRETRLQEVRSAFLAAYSSTVGLRAVAPSPSGAIG GLLEQFARGVGLRSISSNAL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001070993 |
RefSeq Size | 2536 |
RefSeq ORF | 1950 |
Synonyms | C3orf29 |
Locus ID | 64419 |
UniProt ID | Q8NCE2 |
Cytogenetics | 3p25.3 |
Summary | This gene encodes a myotubularin-related protein. The encoded protein is a phosphoinositide phosphatase that specifically dephosphorylates phosphatidylinositol 3,5-biphosphate and phosphatidylinositol 3-phosphate. Mutations in this gene are correlated with autosomal dominant centronuclear myopathy. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 18. [provided by RefSeq, Apr 2010] |
Protein Families | Druggable Genome, Phosphatase, Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411652 | MTMR14 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC421457 | MTMR14 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC421458 | MTMR14 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425875 | MTMR14 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY411652 | Transient overexpression lysate of myotubularin related protein 14 (MTMR14), transcript variant 3 |
USD 396.00 |
|
LY421457 | Transient overexpression lysate of myotubularin related protein 14 (MTMR14), transcript variant 2 |
USD 396.00 |
|
LY421458 | Transient overexpression lysate of myotubularin related protein 14 (MTMR14), transcript variant 1 |
USD 396.00 |
|
LY425875 | Transient overexpression lysate of myotubularin related protein 14 (MTMR14), transcript variant 1 |
USD 396.00 |
|
PH300809 | MTMR14 MS Standard C13 and N15-labeled recombinant protein (NP_071930) |
USD 2,055.00 |
|
PH308660 | MTMR14 MS Standard C13 and N15-labeled recombinant protein (NP_001070994) |
USD 2,055.00 |
|
TP300809 | Recombinant protein of human myotubularin related protein 14 (MTMR14), transcript variant 3 |
USD 823.00 |
|
TP307732 | Recombinant protein of human myotubularin related protein 14 (MTMR14), transcript variant 2 |
USD 823.00 |
|
TP308660 | Recombinant protein of human myotubularin related protein 14 (MTMR14), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review