MTMR14 (NM_001077526) Human Recombinant Protein
CAT#: TP308660
Recombinant protein of human myotubularin related protein 14 (MTMR14), transcript variant 1
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208660 protein sequence
Red=Cloning site Green=Tags(s) MAGARAAAAAASAGSSASSGNQPPQELGLGELLEEFSRTQYRAKDGSGTGGSKVERIEKRCLELFGRDYC FSVIPNTNGDICGHYPRHIVFLEYESSEKEKDTFESTVQVSKLQDLIHRSKMARCRGRFVCPVILFKGKH ICRSATLAGWGELYGRSGYNYFFSGGADDAWADVEDVTEEDCALRSGDTHLFDKVRGYDIKLLRYLSVKY ICDLMVENKKVKFGMNVTSSEKVDKAQRYADFTLLSIPYPGCEFFKEYKDRDYMAEGLIFNWKQDYVDAP LSIPDFLTHSLNIDWSQYQCWDLVQQTQNYLKLLLSLVNSDDDSGLLVHCISGWDRTPLFISLLRLSLWA DGLIHTSLKPTEILYLTVAYDWFLFGHMLVDRLSKGEEIFFFCFNFLKHITSEEFSALKTQRRKSLPARD GGFTLEDICMLRRKDRGSTTSLGSDFSLVMESSPGATGSFTYEAVELVPAGAPTQAAWRKSHSSSPQSVL WNRPQPSEDRLPSQQGLAEARSSSSSSSNHSDNFFRMGSSPLEVPKPRLAALSDRETRLQEVRSAFLAAY SSTVGLRAVAPSPSGAIGGLLEQFARGVGLRSISSNAL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 66.5 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001070994 |
| Locus ID | 64419 |
| UniProt ID | Q8NCE2, Q8WYY9 |
| Cytogenetics | 3p25.3 |
| Refseq Size | 2380 |
| Refseq ORF | 1794 |
| Synonyms | C3orf29 |
| Summary | This gene encodes a myotubularin-related protein. The encoded protein is a phosphoinositide phosphatase that specifically dephosphorylates phosphatidylinositol 3,5-biphosphate and phosphatidylinositol 3-phosphate. Mutations in this gene are correlated with autosomal dominant centronuclear myopathy. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 18.[provided by RefSeq, Apr 2010] |
| Protein Families | Druggable Genome, Phosphatase, Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411652 | MTMR14 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC421457 | MTMR14 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC421458 | MTMR14 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC425875 | MTMR14 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY411652 | Transient overexpression lysate of myotubularin related protein 14 (MTMR14), transcript variant 3 |
USD 436.00 |
|
| LY421457 | Transient overexpression lysate of myotubularin related protein 14 (MTMR14), transcript variant 2 |
USD 436.00 |
|
| LY421458 | Transient overexpression lysate of myotubularin related protein 14 (MTMR14), transcript variant 1 |
USD 436.00 |
|
| LY425875 | Transient overexpression lysate of myotubularin related protein 14 (MTMR14), transcript variant 1 |
USD 396.00 |
|
| PH300809 | MTMR14 MS Standard C13 and N15-labeled recombinant protein (NP_071930) |
USD 2,055.00 |
|
| PH307732 | MTMR14 MS Standard C13 and N15-labeled recombinant protein (NP_001070993) |
USD 2,055.00 |
|
| PH308660 | MTMR14 MS Standard C13 and N15-labeled recombinant protein (NP_001070994) |
USD 2,055.00 |
|
| TP300809 | Recombinant protein of human myotubularin related protein 14 (MTMR14), transcript variant 3 |
USD 823.00 |
|
| TP307732 | Recombinant protein of human myotubularin related protein 14 (MTMR14), transcript variant 2 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China