ETV7 (NM_016135) Human Mass Spec Standard

CAT#: PH307742

ETV7 MS Standard C13 and N15-labeled recombinant protein (NP_057219)

Product Images

Coomassie blue staining of purified ETV7 protein (Cat# TP307742). The protein was produced from HEK293T cells transfected with ETV7 cDNA clone (Cat# RC207742) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207742
• Predicted MW: 39 kDa
• Protein Sequence:
  Sequence Link

  >RC207742 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MQEGELAISPISPVAAMPPLGTHVQARCEAQINLLGEGGICKLPGRLRIQPALWSREDVLHWLRWAEQEY
  SLPCTAEHGFEMNGRALCILTKDDFRHRAPSSGDVLYELLQYIKTQRRALVCGPFFGGIFRLKTPTQHSP
  VPPEEVTGPSQMDTRRGHLLQPPDPGLTSNFGHLDDPGLARWTPGKEESLNLCHCAELGCRTQGVCSFPA
  MPQAPIDGRIADCRLLWDYVYQLLLDTRYEPYIKWEDKDAKIFRVVDPNGLARLWGNHKNRVNMTYEKMS
  RALRHYYKLNIIKKEPGQKLLFRFLKTPGKMVQDKHSHLEPLESQEQDRIEFKDKRPEISP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057219
• RefSeq Size: 1761
• RefSeq ORF: 1023
• Synonyms: TEL-2; TEL2; TELB
• Locus ID: 51513
• UniProt ID: Q9Y603
• Cytogenetics: 6p21.31
• Summary: The protein encoded by this gene belongs to the ETS family of transcription factors, which is a large group of evolutionarily conserved transcriptional regulators that play an important role in a variety of cellular processes throughout development and differentiation, and are involved in oncogenesis as well. This protein is predominantly expressed in hematopoietic tissues. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene (PMID:11108721). [provided by RefSeq, May 2011]
• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Dorso-ventral axis formation