AHSP (NM_016633) Human Mass Spec Standard
CAT#: PH307743
AHSP MS Standard C13 and N15-labeled recombinant protein (NP_057717)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207743 |
Predicted MW | 11.8 kDa |
Protein Sequence |
>RC207743 protein sequence
Red=Cloning site Green=Tags(s) MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQEL RQELNTLANPFLAKYRDFLKSHELPSHPPPSS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_057717 |
RefSeq Size | 518 |
RefSeq ORF | 306 |
Synonyms | EDRF; ERAF |
Locus ID | 51327 |
UniProt ID | Q9NZD4, Q549J4 |
Cytogenetics | 16p11.2 |
Summary | This gene encodes a molecular chaperone which binds specifically to free alpha-globin and is involved in hemoglobin assembly. The encoded protein binds to monomeric alpha-globin until it has been transferred to beta-globin to form a heterodimer, which in turn binds to another heterodimer to form the stable tetrameric hemoglobin. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413883 | AHSP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY413883 | Transient overexpression lysate of alpha hemoglobin stabilizing protein (AHSP) |
USD 396.00 |
|
TP307743 | Recombinant protein of human erythroid associated factor (ERAF) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review