AHSP (NM_016633) Human Recombinant Protein

CAT#: TP307743

Recombinant protein of human erythroid associated factor (ERAF)

Product Images

Coomassie blue staining of purified AHSP protein (Cat# TP307743). The protein was produced from HEK293T cells transfected with AHSP cDNA clone (Cat# RC207743) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207743 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQEL
  RQELNTLANPFLAKYRDFLKSHELPSHPPPSS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 11.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057717
• Locus ID: 51327
• UniProt ID: Q9NZD4, Q549J4
• Cytogenetics: 16p11.2
• Refseq Size: 518
• Refseq ORF: 306
• Synonyms: EDRF; ERAF
• Summary: This gene encodes a molecular chaperone which binds specifically to free alpha-globin and is involved in hemoglobin assembly. The encoded protein binds to monomeric alpha-globin until it has been transferred to beta-globin to form a heterodimer, which in turn binds to another heterodimer to form the stable tetrameric hemoglobin. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]