Interferon regulatory factor 9 (IRF9) (NM_006084) Human Mass Spec Standard

CAT#: PH307768

IRF9 MS Standard C13 and N15-labeled recombinant protein (NP_006075)

Product Images

Coomassie blue staining of purified IRF9 protein (Cat# TP307768). The protein was produced from HEK293T cells transfected with IRF9 cDNA clone (Cat# RC207768) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207768
• Predicted MW: 43.7 kDa
• Protein Sequence:
  Sequence Link

  >RC207768 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASGRARCTRKLRNWVVEQVESGQFPGVCWDDTAKTMFRIPWKHAGKQDFREDQDAAFFKAWAIFKGKYK
  EGDTGGPAVWKTRLRCALNKSSEFKEVPERGRMDVAEPYKVYQLLPPGIVSGQPGTQKVPSKRQHSSVSS
  ERKEEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIGSSSSSSSPEPQEVTDTTEAPFQGDQRSLEF
  LLPPEPDYSLLLTFIYNGRVVGEAQVQSLDCRLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLERGIL
  VASNPRGLFVQRLCPIPISWNAPQAPPGPGPHLLPSNECVELFRTAYFCRDLVRYFQGLGPPPKFQVTLN
  FWEESHGSSHTPQNLITVKMEQAFARYLLEQTPEQQAAILSLV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006075
• RefSeq Size: 1699
• RefSeq ORF: 1179
• Synonyms: IRF-9; ISGF3; ISGF3G; p48
• Locus ID: 10379
• UniProt ID: Q00978
• Cytogenetics: 14q12
• Summary: Transcription factor that mediates signaling by type I IFNs (IFN-alpha and IFN-beta). Following type I IFN binding to cell surface receptors, Jak kinases (TYK2 and JAK1) are activated, leading to tyrosine phosphorylation of STAT1 and STAT2. IRF9/ISGF3G associates with the phosphorylated STAT1:STAT2 dimer to form a complex termed ISGF3 transcription factor, that enters the nucleus. ISGF3 binds to the IFN stimulated response element (ISRE) to activate the transcription of interferon stimulated genes, which drive the cell in an antiviral state. [UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Jak-STAT signaling pathway