Interferon regulatory factor 9 (IRF9) (NM_006084) Human Mass Spec Standard
CAT#: PH307768
IRF9 MS Standard C13 and N15-labeled recombinant protein (NP_006075)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207768 |
Predicted MW | 43.7 kDa |
Protein Sequence |
>RC207768 protein sequence
Red=Cloning site Green=Tags(s) MASGRARCTRKLRNWVVEQVESGQFPGVCWDDTAKTMFRIPWKHAGKQDFREDQDAAFFKAWAIFKGKYK EGDTGGPAVWKTRLRCALNKSSEFKEVPERGRMDVAEPYKVYQLLPPGIVSGQPGTQKVPSKRQHSSVSS ERKEEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIGSSSSSSSPEPQEVTDTTEAPFQGDQRSLEF LLPPEPDYSLLLTFIYNGRVVGEAQVQSLDCRLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLERGIL VASNPRGLFVQRLCPIPISWNAPQAPPGPGPHLLPSNECVELFRTAYFCRDLVRYFQGLGPPPKFQVTLN FWEESHGSSHTPQNLITVKMEQAFARYLLEQTPEQQAAILSLV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_006075 |
RefSeq Size | 1699 |
RefSeq ORF | 1179 |
Synonyms | IRF-9; ISGF3; ISGF3G; p48 |
Locus ID | 10379 |
UniProt ID | Q00978 |
Cytogenetics | 14q12 |
Summary | Transcription factor that mediates signaling by type I IFNs (IFN-alpha and IFN-beta). Following type I IFN binding to cell surface receptors, Jak kinases (TYK2 and JAK1) are activated, leading to tyrosine phosphorylation of STAT1 and STAT2. IRF9/ISGF3G associates with the phosphorylated STAT1:STAT2 dimer to form a complex termed ISGF3 transcription factor, that enters the nucleus. ISGF3 binds to the IFN stimulated response element (ISRE) to activate the transcription of interferon stimulated genes, which drive the cell in an antiviral state. [UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Jak-STAT signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401832 | IRF9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401832 | Transient overexpression lysate of interferon regulatory factor 9 (IRF9) |
USD 396.00 |
|
TP307768 | Recombinant protein of human interferon regulatory factor 9 (IRF9) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review